SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A075AZM3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075AZM3
Domain Number 1 Region: 329-511
Classification Level Classification E-value
Superfamily MIR domain 7.32e-41
Family MIR domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A075AZM3
Sequence length 629
Comment (tr|A0A075AZM3|A0A075AZM3_9FUNG) Glycosyl transferase, family 39 domain-containing protein {ECO:0000313|EMBL:EPZ34034.1} KW=Complete proteome; Reference proteome OX=988480 OS=Rozella allomycis CSF55. GN=O9G_003754 OC=Eukaryota; Fungi; Cryptomycota; Rozella.
Sequence
MTLRNRRDSSKEPRKSINEKETEKDNLIQKKPCNQEKFPMFWYKIVLSISFLTRFLLLNH
PDQVVFDEVHFGKFASYYLRREYYFDVHPPLGKLLIALAGYLVRYDGHFLFDKIGLSYIE
NNVPYIGMRALLAALGSCIAPITFRLLWEMNIGLHGILLACLFIVFDTALVVQSRLILLD
AILLFGIIFSTYSWTKFYKLRNKPFEKDWWKWLTLTGLGLGLTLGTKMVGTFIIFVVGIA
TILDLWRLLDYRRGLSDMTVLKHFLARAVCLIVLPLGIYLASFYIHFAILTKSGPGDHHM
STKFQTQLIGSRLAGDSFRKNFNFIISAVYYGTNVTIRSHVENVFLHSHKERYPLRHNDK
KVSSQGQQVTGYSHEDNNNHWRFHKIDAKLMESDKVIIKNGDIVRLEHVATKSFLLTHDV
ASPLTMTNMEVTTYPFNETLRYNETLWKVEINEEKSDLYSLHETFRLVHLKTKVSLMNYG
KNLPKWGFEQREINGLKDNNAEATYWLIQSIHSDLKFEKDEIRSSNIVKLGFWSKFLELQ
STMLSVNSNLKDDHPFGSRPEHWPLMRRGVSFWEDKEKSQKIYMIGNPIVWIMGFISFAL
LLILITIELILARRGLANEDKCKIIHGIL
Download sequence
Identical sequences A0A075AZM3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]