SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075B7A7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075B7A7
Domain Number 1 Region: 2-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.12e-26
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A075B7A7
Sequence length 109
Comment (tr|A0A075B7A7|A0A075B7A7_HUMAN) Zinc finger protein 780B {ECO:0000313|Ensembl:ENSP00000471726} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ZNF780B OC=Catarrhini; Hominidae; Homo.
Sequence
MVHGSVTFRDVAIDFSQEEWECLQPDQRTLYRDVMLENYSHLISLGSSISKPDVITLLEQ
EKEPWIVVSKETSRWYPDLESKYGPEKISPENDIFEINLPKHVIKQISK
Download sequence
Identical sequences A0A075B7A7 A0A2J8QFR3
ENSP00000471726 ENSP00000471726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]