SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075FJR1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075FJR1
Domain Number 1 Region: 18-79
Classification Level Classification E-value
Superfamily DsrEFH-like 0.0000000235
Family DsrEF-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A075FJR1
Sequence length 81
Comment (tr|A0A075FJR1|A0A075FJR1_9ARCH) Uncharacterized protein {ECO:0000313|EMBL:AIE91443.1} OX=1455890 OS=uncultured marine thaumarchaeote AD1000_11_E10. GN= OC=Archaea; Thaumarchaeota; environmental samples.
Sequence
MSFENSELKNKFSDAINSNKIQNIEQMIKTLRETGLVKFYVCSASLSIMNINENDLVVVD
GIMGLSTFLNKAENASIVLYI
Download sequence
Identical sequences A0A075FJR1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]