SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075FUC2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075FUC2
Domain Number 1 Region: 3-141
Classification Level Classification E-value
Superfamily Nop domain 3.14e-49
Family Nop domain 0.00004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A075FUC2
Sequence length 154
Comment (tr|A0A075FUC2|A0A075FUC2_9ARCH) Ribosomal biogenesis protein (NOP56) {ECO:0000313|EMBL:AIE93252.1} OX=1455908 OS=uncultured marine thaumarchaeote AD1000_33_B07. GN=NOP56 OC=Archaea; Thaumarchaeota; environmental samples.
Sequence
MQTLANQILDLFELRKTIEEHIEEQMNEELPNITAVLGAAVGARILAHAGSLKRLSSMPA
STIQILGAEKALFRSLKTGANPPKHGILFQHATVHAAPKWQRGKIARAVAGKAAIAARVD
VYGGGLNQTLLDKLNIRVQEIGKNMPSQQKRTKT
Download sequence
Identical sequences A0A075FUC2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]