SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A075FYR2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075FYR2
Domain Number 1 Region: 239-500
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.84e-55
Family PFOR Pyr module 0.021
Further Details:      
 
Domain Number 2 Region: 5-143,170-222
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.27e-18
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A075FYR2
Sequence length 505
Comment (tr|A0A075FYR2|A0A075FYR2_9ARCH) Pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein (KorA) {ECO:0000313|EMBL:AIE96324.1} OX=1455940 OS=uncultured marine thaumarchaeote AD1000_77_H06. GN=korA OC=Archaea; Thaumarchaeota; environmental samples.
Sequence
MVFDYSWLIGGPQGSGVDTAANIFSRVGTKLGYHVFGKREYHSNIKGLHSYFVVRLSDNK
IRSNVNGANIMVAFDAETMIRHGLSISKNGAIIYDSSIVNTSIDEIPTIEADHRVRLDEF
FKSKNMEPKVSSIIELAKESGVNVYPISFWDALSNIADELKRPELSRMTRMFNVLGVSFS
LGVLKAPIAPLLESIEEIFSAKPTIADLNKKAANFAYNYASAKFSGFNASLNETDKEPNV
MLVQGHQGSALGKMVCGCRFQSYYPITPASDESEFLETHEILQVKEDRPGSTTIVQTEDE
ISAIGMAVGASLTGTRSATSTSGPGFSLMAETLGWAAINEVPVVISLFQRSGPSTGLPTR
QGQDDLLFAINAGHGEFPRIVYASGDVEDSFYDTGKCFNFADVFQLPVIHILDKFIASSV
VTCNRFEPDLVSIDRGKLLEKIDGDYKRFAHSPDGISPRSKLGLENGVFWNTGDESDEHG
HISEDPVNRIQMMDKRQKKLSKFLL
Download sequence
Identical sequences A0A075FYR2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]