SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075G6K1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075G6K1
Domain Number 1 Region: 84-138
Classification Level Classification E-value
Superfamily Methionine synthase domain 0.0000562
Family Methionine synthase domain 0.013
Further Details:      
 
Domain Number 2 Region: 7-98
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000985
Family ROK associated domain 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A075G6K1
Sequence length 297
Comment (tr|A0A075G6K1|A0A075G6K1_9ARCH) Putative transcriptional regulator {ECO:0000313|EMBL:AIE99600.1} OX=1455988 OS=uncultured marine thaumarchaeote KM3_115_A11. GN= OC=Archaea; Thaumarchaeota; environmental samples.
Sequence
MTRGYQIEDIKEKLLEVLHNSKTGVSGLEISERLNINRITMAKYLKVFAAEGLLKQKNFG
NVNLWFIEDGTEKYHFPEDYFKIKTKYFEFLTRMQENLVYNLIRNCYHSGAQPMKIISEI
ISPGIEAVQSNYNQGKIGKSELNFLEKIISNSIQIINLENIEVNPKKNVIIISADYQSSL
LVEAASASFHTDGWQVFSLGDMSSAIDVLFDLDLQKFVTKIWKSRMGIMIIVIFSSTEDG
LKFFAESVNSIKSKFRKNLYLALCGNIKKNTGIEADLIGENLETTLQWSQTTFGSST
Download sequence
Identical sequences A0A075G6K1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]