SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A075GD66 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075GD66
Domain Number 1 Region: 240-500
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.63e-55
Family PFOR Pyr module 0.026
Further Details:      
 
Domain Number 2 Region: 5-221
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.7e-19
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.018
Further Details:      
 
Domain Number 3 Region: 519-627
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.86e-19
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A075GD66
Sequence length 635
Comment (tr|A0A075GD66|A0A075GD66_9ARCH) Pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein (KorA) {ECO:0000313|EMBL:AIF01559.1} OX=1456013 OS=uncultured marine thaumarchaeote KM3_149_F07. GN=korA OC=Archaea; Thaumarchaeota; environmental samples.
Sequence
MAFDFSWLIGGPQGSGVDTAANIFSRVGAKLGYHVFGKREYHSNIKGLHSYFVVRLSDKK
IRSNINGANFMVAFDAETMIRHGLDVSKGGAIIYDSSIVNTTIDEIPTLETSYSVQLSEF
FSSKNMEPNVSSVIELAKQNGVKVYPISFRDTLANIADELKSPELSRMVRMFNVLGVSFS
LGVLKAPIEPLLESIDNIFSKKPSISDLNKKAANFSYNYASAKFSDFNNSISEISKEANT
IIVQGHQGSALGKMVCGCRFQSYYPITPASDESEFLESNEILNVKEDRPGSTTIVQTEDE
ISAIGMAVGASLTGTRSATSTSGPGFSLMAETLGWAGINETPIVITLFQRSGPSTGLPTR
HGQDDLLFAINAGHGEFPRIVYASGDVEDSFYDTGKCFNFADIFQVPVIHILDKFIASSV
VTCKRFEPDLVSIDRGKLLEKVDGDYKRFAHSPDGISPRSKLGLENGVFWNTGDESDEYG
HISEDPVNRIQMMDKRQKKVEQILTLIPKNDQAVAYGKSDICILSWGSPKGPILDAIEMH
RKEGHEIGFIDIKLLEPFPTEHVKSLLKDSSTIVDIEANMTAQLGSLIRKNLLKDPDYYV
LKYTGRPMTCIEIFDSLKKIIEKKAEKKQVLLYGN
Download sequence
Identical sequences A0A075GD66

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]