SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075H3Q0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075H3Q0
Domain Number 1 Region: 3-193
Classification Level Classification E-value
Superfamily ITPase-like 2.51e-42
Family ITPase (Ham1) 0.0000586
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A075H3Q0
Sequence length 198
Comment (tr|A0A075H3Q0|A0A075H3Q0_9EURY) Ham1 related protein (RdgB) {ECO:0000313|EMBL:AIF09820.1} OX=1456445 OS=uncultured marine group II/III euryarchaeote KM3_41_A09. GN=rdgB OC=Archaea; Euryarchaeota; environmental samples.
Sequence
MKRLLFLTGNAGKLAEASHFFEPLGYQVEQFLVDGKVPIVVEPQSDSLKDVAIAKIEQAK
ALFNQTGQEAAIFVEDAGLFIDELSGFPGVNSASVLNQIGLSGILNLMSETINRGAEFRA
HAVLFTGGELVFGEGICRGTITTETLGESGFGYDPIFSPEGEDSGLTFGQMDKTAKEAFS
HRAKALESIKKQLDLLGR
Download sequence
Identical sequences A0A075GF07 A0A075H3Q0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]