SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075I2N1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075I2N1
Domain Number 1 Region: 22-94
Classification Level Classification E-value
Superfamily AF1782-like 5.1e-19
Family AF1782-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A075I2N1
Sequence length 98
Comment (tr|A0A075I2N1|A0A075I2N1_9ARCH) Diphthine synthase (DPH5) {ECO:0000313|EMBL:AIF22876.1} OX=1456376 OS=uncultured marine thaumarchaeote SAT1000_10_H08. GN=DPH5 OC=Archaea; Thaumarchaeota; environmental samples.
Sequence
MLTECLDKPSDNSDKIKSVSVQMIEKYVPMVRKALEEIRPLYNDSKEFQEVFENAKLYID
DAENFLKQGKDENAVLSIGYADGLVDALRIAKGIDPKM
Download sequence
Identical sequences A0A075I2N1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]