SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A075LFR9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075LFR9
Domain Number 1 Region: 1-109
Classification Level Classification E-value
Superfamily SpoIIaa-like 4.91e-19
Family Anti-sigma factor antagonist SpoIIaa 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A075LFR9
Sequence length 118
Comment (tr|A0A075LFR9|A0A075LFR9_9BACI) RsbT antagonist protein RsbS {ECO:0000313|EMBL:AIF65525.1} KW=Complete proteome; Reference proteome OX=586416 OS=Terribacillus aidingensis. GN=GZ22_01855 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Terribacillus.
Sequence
MRIPILKLHNYLLISIQIDLDDQTAIQFQEDLLNKIHQSGATGVVIDLTSVDIIDSFIAK
VLGDVVTMSDLMGAKVVLTGIQPAVAVTLIDLGIHLNEVTTALDLEQGLIKLRQELEE
Download sequence
Identical sequences A0A075LFR9 A0A1G6RY76 A0A1H8IGG6 A0A268BMX4 A0A268I0K1
WP_038558142.1.62228 WP_038558142.1.76276 WP_038558142.1.87244 WP_038558142.1.96502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]