SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A075PG60 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075PG60
Domain Number 1 Region: 400-486
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000216
Family Anti-sigma factor antagonist SpoIIaa 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A075PG60
Sequence length 495
Comment (tr|A0A075PG60|A0A075PG60_PSEFL) Sulfate transporter {ECO:0000313|EMBL:AIG02268.1} KW=Complete proteome OX=294 OS=Pseudomonas fluorescens. GN=HZ99_08925 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MFETIKANWLSNVRADVLAGLVVALALIPEAIAFSIISGVDPKVGLYASFCICTVIAFVG
GRPAMISAATGAMALLMVNLVKDHGLQYLLAATLLCGVIQIIAGYLKLGELMRFVSRSVV
TGFVNALAILIFMAQLPELTGVTWPVYAMTAGGLAIIYLFPRVPVIGRLLPSPLVCIIVL
TAIAMYLGLKVHTVGDMGALPNSLPIFMWPSVPLNLDTLLIVLPYSAALAVVGLLESMMT
ATIVDDLTDTPSDKNRECKGQGIANIATGMIGGMAGCAMIGQSMINVKSGGRTRLSTLSA
GVLLLVMMLFLGDWLARIPMAALVAVMIMVSISTFNWASIRNLKQYPLSTNIVMVVTVVV
VVATHNLAYGVVAGTLLAAMFFANKIGHYLDVTSKRDPENSRRTYYVVGQVFFGSADRFT
SAFDLKEKLETLTIDLREAHFWDITAVAALDKVVLKLRKAGAVVDVIGMNQATATLVDRF
GVHDKPDGIDTLMGH
Download sequence
Identical sequences A0A075PG60
WP_038442413.1.88896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]