SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075PGB1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075PGB1
Domain Number 1 Region: 1-41
Classification Level Classification E-value
Superfamily Ribosomal protein L36 0.00000000000000772
Family Ribosomal protein L36 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A075PGB1
Sequence length 49
Comment (tr|A0A075PGB1|A0A075PGB1_PSEFL) 50S ribosomal protein L36 {ECO:0000256|HAMAP-Rule:MF_00251, ECO:0000256|RuleBase:RU000571} KW=Complete proteome OX=294 OS=Pseudomonas fluorescens. GN=HZ99_23175 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MKVLSSLKEAKNRHRDCQIVKRRGRIYVICKSNPRFKARQGGAKNKNKG
Download sequence
Identical sequences A0A075PGB1 A0A1H5DL35 A0A1S1UNY8 A0A1T1IE46 W2DLN5
WP_020297337.1.13214 WP_020297337.1.1594 WP_020297337.1.33834 WP_020297337.1.37686 WP_020297337.1.46796 WP_020297337.1.55829 WP_020297337.1.56081 WP_020297337.1.81815 WP_020297337.1.83445 WP_020297337.1.87624 WP_020297337.1.88896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]