SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A075QXI3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A075QXI3
Domain Number - Region: 239-299
Classification Level Classification E-value
Superfamily MIR domain 0.0418
Family MIR domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A075QXI3
Sequence length 335
Comment (tr|A0A075QXI3|A0A075QXI3_BRELA) Putative membrane-bound metal-dependent hydrolase {ECO:0000313|EMBL:AIG25082.1} KW=Complete proteome; Reference proteome OX=1042163 OS=Brevibacillus laterosporus LMG 15441. GN=BRLA_c007240 OC=Brevibacillus.
Sequence
MDTATHFAIGFGLAALAHLDPVVANDPGLAEAVMIGTVIGQQAPDFDGFTRLLGNATYIR
NHRGASHSIPAIFIWTLSICGLIQYFIPQVHWGHLLGWTFFAVFLHVFVDIFNAYGTQAL
RPFNRKWVALCTMFIFDPLIFALHIIGLLLWAAGAEPGKLFLVIYLFIALYYVKRYRVHA
RELAYLQSSLGLKGEYTLIPTYSWSNWTFVVKTTQQWYVGEMHQGSEPLVLDIFPIPKEE
PELITITRQDKKVQAFLSFTHHVHAEVIQRSFGYEVKWKDLRYRAKHMGKSHYMLVAVVY
LDQNKQIRDSFVGWIHHSEDQLTKKLNPQKEIQVN
Download sequence
Identical sequences A0A075QXI3 H0UE52
WP_003335426.1.38728 WP_003335426.1.89784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]