SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A075R4E5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075R4E5
Domain Number 1 Region: 436-543
Classification Level Classification E-value
Superfamily SpoIIaa-like 7.65e-19
Family Anti-sigma factor antagonist SpoIIaa 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A075R4E5
Sequence length 586
Comment (tr|A0A075R4E5|A0A075R4E5_BRELA) Dicarboxylic acid uptake system A {ECO:0000313|EMBL:AIG26336.1} KW=Complete proteome; Reference proteome OX=1042163 OS=Brevibacillus laterosporus LMG 15441. GN=BRLA_c020150 OC=Brevibacillus.
Sequence
MKLSGRFEHYNSTYFRHDLISGLIVGVIAIPLGMAFAIAAGVSPQYGIYTTIIAGFLISF
FGGSKFQIGGPTGAFIPILFAIVMQYGYENLLIAGLLAGVMLVLMGILRLGALIAFIPRP
VTIGFTSGIAVIIFTGQIANFLGLTGVQRHQDFLSNMRELGIHLSTINPYSIVTALICFA
ILLITPKLFPKIPGSLIGLILSSLLAAWFFEGKVATIGSTYGEIPSTLPHFHIPDITLDR
IVQLLKPAFVIALLGGIESLLSAVVADGMTGTRHKSNRELIGQGIANMITPLFGGIPATG
AIARTATNIKSGAKSPISGIIHSLVVLIVLMLFAPWASSIPLASMAPILMVVAWNMSERK
AFTHIVKTKTSDSLVLVITFFLTVLTDLVTAVEAGLILAIILFVKRMRDILTVAKVLPDP
TVKHEKMSPHMVKEGHDCPQIAIFTIEGALFFGAAAMFESSIMQTIHYRPKILLLKMAKV
PFMDTTGESNLANVVNDFTRNGGKVLISGIQTQPKEVITKTGLADKIGEEHFFAHTGEAI
EYALTQLDYQKCLGCKHFSFRECTVLSDPNAAKQQSVLPIKQLSEQ
Download sequence
Identical sequences A0A075R4E5
WP_003337180.1.89784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]