SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A075UNX3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075UNX3
Domain Number 1 Region: 21-111
Classification Level Classification E-value
Superfamily SpoIIaa-like 3.14e-19
Family Anti-sigma factor antagonist SpoIIaa 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A075UNX3
Sequence length 114
Comment (tr|A0A075UNX3|A0A075UNX3_9PSEU) Anti-sigma factor antagonist {ECO:0000256|RuleBase:RU003749} KW=Complete proteome OX=208439 OS=Amycolatopsis japonica. GN=AJAP_08475 OC=Amycolatopsis.
Sequence
MAIDSEAGQAAPLVVAEAARSEDAITVEVAGDIDISTSPRLRAELFELVAHGPGTAVVDM
TGVGFCDSSGLSVLVQLNRQCQESGIDLSFAPSKVVRRAIELTGLLPTLKMAGD
Download sequence
Identical sequences A0A075UNX3
WP_038509429.1.1574 WP_038509429.1.62950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]