SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075VV08 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075VV08
Domain Number 1 Region: 3-112
Classification Level Classification E-value
Superfamily S13-like H2TH domain 2.2e-32
Family Ribosomal protein S13 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A075VV08
Sequence length 116
Comment (tr|A0A075VV08|A0A075VV08_CAPAN) Ribosomal protein S13, mitochondrial {ECO:0000313|EMBL:PHT69461.1} KW=Complete proteome; Reference proteome OX=4072 OS=Capsicum annuum (Bell pepper). GN=T459_23917 OC=Capsiceae; Capsicum.
Sequence
MLYISGARLVGDEQVRIASTKIDGIGPKKAIQVRYRLGISGNIKIKELTKYQIDQIEQMI
GQDHVVHWELKRGERADIERLISISCYRGIRHQDGSPLRGQRTHTNARTCRKRIRK
Download sequence
Identical sequences A0A075VV08 A0A1U8QDD2
YP_009049641.1.72714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]