SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075W801 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075W801
Domain Number 1 Region: 4-100
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 9.13e-40
Family MHC antigen-recognition domain 0.0000301
Further Details:      
 
Domain Number 2 Region: 100-198
Classification Level Classification E-value
Superfamily Immunoglobulin 3.57e-29
Family C1 set domains (antibody constant domain-like) 0.0000875
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A075W801
Sequence length 217
Comment (tr|A0A075W801|A0A075W801_9AVES) MHC class II beta {ECO:0000313|EMBL:AIG95814.1} OX=1200804 OS=Hydrobates monteiroi (Monteiro's storm-petrel). GN=MHCIIB OC=Hydrobates.
Sequence
GAHLARGEETSGYFQYVFKADCYFTNGTERVRLVVRKIYNRQQYAHFDSDVGFFVADTPL
GEPSAKYWNSQPDVLEQERAAVDTFCRHNYRVGTPITLERRVQPKVRVSPMQSSSLPQTD
RLVCYVTGFYPAEIEVKWFKNGQEETERVVSTDVIQNGDWTYQVLVMLETTPQRGDTYTC
QVEHVSLQHPLTQHWEVQSDXARSKMLTGVGGFVLGL
Download sequence
Identical sequences A0A075W801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]