SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075W9B4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075W9B4
Domain Number 1 Region: 2-88
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 6.57e-34
Family MHC antigen-recognition domain 0.0000683
Further Details:      
 
Domain Number 2 Region: 87-137
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000222
Family C1 set domains (antibody constant domain-like) 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A075W9B4
Sequence length 144
Comment (tr|A0A075W9B4|A0A075W9B4_DRONO) MHC class II beta {ECO:0000313|EMBL:AIG95845.1} OX=8790 OS=Dromaius novaehollandiae (Emu). GN=MHCIIB OC=Dromaius.
Sequence
YFQWDFKCSCYFTNNSEQVRFVEWYIYNRQTLVHFDSDVGIYVADSPLGEPSAKYWNSQP
DFIEQKRAAVDRFCRHNYEVSTPYAVQRKVQPEVEIYPVQSGSLPQTDRLVCAVMDFYLP
EIEVKWFKNGREETERVVATDVIQ
Download sequence
Identical sequences A0A075W9B4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]