SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075WE02 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075WE02
Domain Number 1 Region: 9-127
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 2.39e-22
Family HEPN domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A075WE02
Sequence length 128
Comment (tr|A0A075WE02|A0A075WE02_ARCFL) Uncharacterized protein {ECO:0000313|EMBL:AIG98620.1} KW=Complete proteome OX=1344584 OS=Archaeoglobus fulgidus DSM 8774. GN=AFULGI_00018650 OC=Archaeoglobaceae; Archaeoglobus.
Sequence
MGIEEMEILRERAFKFLKNAEQLIESGVYDIAAFNIQQFVELYLKYALFKKVGDYPKTPS
IKRLLREIGKASGKIDAVEEFMRENIDRISNVENAYITSRYIPSEFERIEVENMLKLARK
IRDLVDAL
Download sequence
Identical sequences A0A075WE02 A0A101DE26 O28659
224325.AF1614 WP_010879111.1.27515 WP_010879111.1.34637 WP_010879111.1.46508 AF1614_1_128 gi|11499206|ref|NP_070443.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]