SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A075WEE9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A075WEE9
Domain Number 1 Region: 10-100
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 1.96e-37
Family MHC antigen-recognition domain 0.0000493
Further Details:      
 
Domain Number 2 Region: 100-197
Classification Level Classification E-value
Superfamily Immunoglobulin 7.41e-29
Family C1 set domains (antibody constant domain-like) 0.0000771
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A075WEE9
Sequence length 217
Comment (tr|A0A075WEE9|A0A075WEE9_BUTBU) MHC class II beta {ECO:0000313|EMBL:AIG95736.1} OX=30397 OS=Buteo buteo (Eurasian buzzard). GN=MHCIIB OC=Accipitrinae; Buteo.
Sequence
GARPGGGQLTSGFFQEMTKFECHHLNGNKNVRYLEKYISNREQTVHFDSDVGHYVADTPL
GEPDAKYWNSQPDILERKRAEVDRLCRHNYEVVTPFTVERRVEPKVRVSPMQSSSLPQTN
RLVCYVTGFYPAEIEVKWFKNGQEETEHVVSTDVIQNGDWTYQVLVMLETTPQRGDTYAC
QVEHVSLQHPVTQQWEVQSDAARSKMLTGVGGFVLGL
Download sequence
Identical sequences A0A075WEE9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]