SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A076EBX3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A076EBX3
Domain Number 1 Region: 1-108
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.75e-17
Family Anti-sigma factor antagonist SpoIIaa 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A076EBX3
Sequence length 116
Comment (tr|A0A076EBX3|A0A076EBX3_RHOOP) Anti-sigma factor antagonist {ECO:0000313|EMBL:AII03765.1} KW=Complete proteome OX=37919 OS=Rhodococcus opacus (Nocardia opaca). GN=EP51_03710 OC=Rhodococcus.
Sequence
MAVEFAPDADATVGRISGDIDVLAAPSFALALAHLTDGGSSSRIIVDMTAVDFVGTSGLS
ILSEFAESARRQHITWVLAGNRAVLRPVEAIGLDAVIPTCRTVRDAFDRVGKIAHS
Download sequence
Identical sequences A0A076EBX3 X0PRR7
WP_037232258.1.99080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]