SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A076EMC4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A076EMC4
Domain Number 1 Region: 714-918
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.31e-21
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.01
Further Details:      
 
Domain Number 2 Region: 428-610
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.000000000000535
Family Pyruvate oxidase and decarboxylase PP module 0.064
Further Details:      
 
Domain Number 3 Region: 49-219
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.00000000224
Family Pyruvate oxidase and decarboxylase Pyr module 0.065
Further Details:      
 
Domain Number 4 Region: 271-391
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.000000191
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A076EMC4
Sequence length 1165
Comment (tr|A0A076EMC4|A0A076EMC4_RHOOP) 2-oxoacid ferredoxin oxidoreductase {ECO:0000313|EMBL:AII07280.1} KW=Complete proteome OX=37919 OS=Rhodococcus opacus (Nocardia opaca). GN=EP51_22545 OC=Rhodococcus.
Sequence
MQTRSSTFSLDDRYVLEDGSVYLTGIQGLVRVLRDRAILDRRRGHRTSSFASGYEGSPLA
GYDLEIARKRKILDEYDLVHRPGVNEELAATAVLGTQMAPQIGHLRSDGVTGYWYGKSPG
LDRASDAIRHANLVGTDPRGGAVALVGDDPGGKSSSLACASEVAMADLLIPTLYPADSQE
VLDYGVHAPFLSRFTGLWSGLKIVTAVADGASSAVVHPDRIDPSFGDLGPSTYTPNANLV
GPNLLTLERSQMMDRLPRALDYARINRLNQIVQSGPDDRIGIVTSGKTYLDLREALSLFG
LGPADLLRYGIRILKLGMIYPVDPEIVHRFAAGLDEIIVVEEKRAFLETAVRDILYRRAN
APVVIGKTDPNGKSLVNIFGELDADLIANALSRRLGDEYGIEPVQLWRQRPRTSKIALPL
LNRTPYFCSGCPHNSSTKVAPDTLIGGGIGCHAMVMMMDDKQVGDVIGLTQMGGEGAQWI
GMAPFLEENHLIQNIGDGTFMHSGSLALRAAVASGENVTYKLLYNATVAMTGGQDPVGAM
PLDRITRLLLAEGVKKVVVTTEDRKRIGSLKLPKGVEIRDRDDLVDVQTELATIAGVTVL
VHDQECAAEKRRKRKRGTLPTPTTRVMINERICEGCGDCGEKSNCLSVHPTDTEFGRKTT
IHQSSCNLDFSCLKGDCPSFVTITPGPKEQRTPVPAIAADLITDPDVPAIDGQFGMRIMG
VGGTGVITVAQVLATAAVIDGKFVRSLDQTGLAQKGGAVVSDLKISAEPREGASKIGEGR
CGLYLGCDSLVATDPNNLKVANSSDTVAVVSTTEIPTGQMIVDTAVHFPELSTIRTAVDG
ATSRAIYLDPALLSRELFDDEQYTNMLLIGAAFQTGVLPIEATAIEQAITLNGVSIEANL
QAFRRGRQAIADPEALTAAIEGNRRADFEPAVPSLQALALAGTVRASADSELARIVGLRT
AELIDYQGIDYARDYAQFVESVRQREAALVGHSTALTEAVAKNLFKLMAYKDEYEVARLA
LDPAFDAAVKDAFGKSAKRSVRLHPPMLRAMGMKNKLSLGSWINPGFRTLHRMRKIRGTK
LDVFGYHHIRKMERELITEYREAIEQLLHLLNPHSVSAAVEIAELPDLVRGYEQIKVANV
ASYHQELHKLLEAYPLAARAEKQAV
Download sequence
Identical sequences A0A076EMC4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]