SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A076FEJ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A076FEJ7
Domain Number 1 Region: 46-196
Classification Level Classification E-value
Superfamily Carbamoyl phosphate synthetase, large subunit connection domain 7.32e-53
Family Carbamoyl phosphate synthetase, large subunit connection domain 0.00022
Further Details:      
 
Domain Number 2 Region: 203-282
Classification Level Classification E-value
Superfamily PreATP-grasp domain 3.02e-30
Family BC N-terminal domain-like 0.00015
Further Details:      
 
Domain Number 3 Region: 2-51
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 0.0000000000000168
Family BC ATP-binding domain-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A076FEJ7
Sequence length 283
Comment (tr|A0A076FEJ7|A0A076FEJ7_9NEOP) Cadherin-like protein {ECO:0000313|EMBL:AII16418.1} OX=1527098 OS=Chimarra veveensis. GN=CAD OC=Philopotamoidea; Philopotamidae; Chimarrinae; Chimarra.
Sequence
SLDYCVVKIPRWDLSKFNRVCPKIGSSMKSVGEVMAIGRKFEEAFQKALRMVDENVNGFD
PNLKSVNEGELAEPTDKRMFVLAAALKAEFTIDRLYDLTRIDKWFLKKMKNIVDFYMALE
SIDQHDMTRDILKKAKQMGFSDKQIATAVRSTELAIRNQRTEFGVTPFVKQIDTVAAEWP
ATTNYLYTTYNACEHDLTFPGGFVMVLGSGVYRIGSSVEFDWCAVGCLRELKLLDKRTIM
VNYNPETVSTDYDMCDRLYFEEISFEVVMDIYNLENPEGVILS
Download sequence
Identical sequences A0A076FEJ7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]