SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A076FIK3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A076FIK3
Domain Number 1 Region: 12-343
Classification Level Classification E-value
Superfamily Bacterial photosystem II reaction centre, L and M subunits 2.62e-146
Family Bacterial photosystem II reaction centre, L and M subunits 0.0000000000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A076FIK3
Sequence length 353
Comment (tr|A0A076FIK3|A0A076FIK3_9DIPS) Photosystem II protein D1 {ECO:0000256|RuleBase:RU004332} OX=1127633 OS=Viburnum amplificatum. GN=psbA OC=Pentapetalae; asterids; campanulids; Dipsacales; Adoxaceae; Viburnum.
Sequence
MTAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI
DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL
LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAAAAVFLIYPIGQGSFSDGMPLGISGTF
NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFG
QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF
NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLAALEAPSTNG
Download sequence
Identical sequences A0A076FIK3 A0A076FIL4 A0A076FJX6 A0A076FKM9 A0A076FQ89

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]