SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A076GV04 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A076GV04
Domain Number - Region: 41-155
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.00231
Family Ricin B-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A076GV04
Sequence length 181
Comment (tr|A0A076GV04|A0A076GV04_ENTFC) Uncharacterized protein {ECO:0000313|EMBL:AII40569.1} KW=Complete proteome OX=1344042 OS=Enterococcus faecium T110. GN=M395_09295 OC=Enterococcus.
Sequence
MKKAKLILSTIVLTSLCSGFLGTGTVDASEHARNTYNNKVVSLLAASDPTLAMTHTEPDP
YLWNELFMETYAPSNAAQRWVMEYNENSGGYYIREETPLFSSRPFYLVYSGGWFINPNLS
KGDEGSLWQLIPAGNAYFVRNMARDEYLTWHLGGSGLLDVGVTAFNWDREQRFTVQVVGE
V
Download sequence
Identical sequences A0A076GV04 A0A2D0CBE6 J6JRJ2
WP_002375244.1.20924 WP_002375244.1.23483 WP_002375244.1.46273 WP_002375244.1.54763 WP_002375244.1.55567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]