SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A076H1B7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A076H1B7
Domain Number 1 Region: 28-195,257-276
Classification Level Classification E-value
Superfamily Cytochrome f, large domain 1.57e-92
Family Cytochrome f, large domain 0.00000014
Further Details:      
 
Domain Number 2 Region: 196-257
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 6.59e-17
Family Cytochrome f, small domain 0.00085
Further Details:      
 
Domain Number 3 Region: 273-308
Classification Level Classification E-value
Superfamily Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor 0.0000000000000249
Family Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A076H1B7
Sequence length 310
Comment (tr|A0A076H1B7|A0A076H1B7_9SYNE) Cytochrome f {ECO:0000256|HAMAP-Rule:MF_00610} KW=Complete proteome; Reference proteome OX=1280380 OS=Synechococcus sp. KORDI-100. GN=KR100_04735 OC=Synechococcus.
Sequence
MRRHLSLLLGSLVLGLAVLIAPAASWAYPFWAQQNYESPREATGKIVCANCHLAQKLTQA
EVPQAVLPDSVFKASVKIPYEDGLQEIGADGSDVPLQVGAVVMLPDGFTLAPQDRWTDEI
REETEGVYFSQYSDDQPNILLVGPIPGDQHQEIVFPVLSPDPATDSNIHFGKYQIHVGGN
RGRGQVYPTGEKSNNTAFTAAASGTVSAIEDGENGAKLVTINTTEGDSTTETVPVGPALL
VNVGDSVEAGAPLTNDPNVGGFGQVDAEVVLQNPVRIYGLLAFFAAVALAQIMLVLKKKQ
VEKVQAAEGF
Download sequence
Identical sequences A0A076H1B7
WP_038543521.1.73772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]