SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A076HEU1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A076HEU1
Domain Number 1 Region: 3-79
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 1.02e-22
Family F1F0 ATP synthase subunit C 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A076HEU1
Sequence length 82
Comment (tr|A0A076HEU1|A0A076HEU1_9SYNE) Lipid-binding protein {ECO:0000256|HAMAP-Rule:MF_01396} KW=Complete proteome OX=585423 OS=Synechococcus sp. KORDI-49. GN=KR49_06290 OC=Synechococcus.
Sequence
MDSITSAASVVAAGLAVGLAAIGPGIGQGTASGGAVEGIARQPEAEGKIRGTLLLSLAFM
ESLTIYGLVVALVLLFANPFAG
Download sequence
Identical sequences A0A076H645 A0A076HEU1 A0A076HLV5 A0A0H5Q5E4 A0A1Z8P5Z4 A0A2E7LVZ1 A5GV76 Q3AHK1 Q7U8W9 W0H1D7
gi|33865026|ref|NP_896585.1| MES00002953823 WP_006851467.1.100374 WP_006851467.1.22971 WP_006851467.1.26789 WP_006851467.1.28472 WP_006851467.1.53145 WP_006851467.1.53453 WP_006851467.1.55822 WP_006851467.1.69047 WP_006851467.1.73772 110662.Syncc9605_2192 316278.SynRCC307_1882 84588.SYNW0490 gi|148242981|ref|YP_001228138.1| gi|78213707|ref|YP_382486.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]