SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A076HV94 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A076HV94
Domain Number 1 Region: 277-471
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 7.57e-48
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00021
Further Details:      
 
Domain Number 2 Region: 7-191
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 3.27e-47
Family Methylesterase CheB, C-terminal domain 0.00032
Further Details:      
 
Domain Number 3 Region: 209-279
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.000000000000017
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0067
Further Details:      
 
Domain Number 4 Region: 840-925
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000855
Family Heme-binding PAS domain 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A076HV94
Sequence length 971
Comment (tr|A0A076HV94|A0A076HV94_9BACT) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome; Reference proteome OX=1356852 OS=Hymenobacter sp. APR13. GN=N008_16040 OC=Hymenobacter.
Sequence
MGGVLSFPIVCLGGSAGSLVALEHFLRAVSPNSGLAYIIVTHQMPTQDGELTRVLQHFTA
LPVHEVTDGMKVRPNHVYVIPPGRDMSLLHGALHLFEFTQAPGRRLPIDYFLQSLAKDAR
DRAVCIILSGMGADGSIGLKMVMENFGMVMVQEPEEAEFDSMPRAAIATEFVDFVLPAAD
MPAHLLEYGRQPPLRRPLRATPAEAQGGMPAHALQKIFILIRNQTGHDFSFYKRNTVFRR
IERRMNGHQIREFTHYVRYLQHSPEEVELLFKELLIGVTKFFRDGEAFASLKRHLQPMLR
QVPSGTTVRVWAPGCSTGEEAYSLAMTLLECFEAEPGRNLSLQIFATDISTEGIEAARAG
LYTSNIAADVSPERLRRFFHKLDGDSYQIRKEVRDSVVFALHNLNKDAPFTKLDLLCCRN
LLIYLSAELQKNLIPIFHYALNPNGLLFLGPSENLTGFQDLFVPLDVKWKISRRAEGAAS
LVRLANFPFASGQQAPVALPANSLAMTPATPRRDGLFASLVQRTLLGAFAPPAVVVNAKG
DILFVNGRTGRYLEPAPGLSGMNIFDMARDELRFEISDAVHRASHEQQSVVSEGLRVKTE
AGYQLLRLRVTYLAAPELLSGLLLVSFEDVETPRRVRQGKPTATASATRADLVTALEKEL
QHTRHRLQTTIEEMESSLEELKSTNEELQSANEELQSTNEEAMTNKEEMQSLNEELMTLN
MQYLSKTEELSQAANDMKNLLDATEIATIFLDNDMLIKRFTPPVGRIISLLPSDVGRPIT
HFASNLRYDNLAATVQQVLDRLVSAEATIQTTAGDWYAMRILPYRTLENYISGAVITFTD
VTTMKQLEQQMQASRRLAESIVETVREPLLVLDKQLRILTVSQAFATTFGVEAAAVKGHE
LGGLGKGAWQQQALYQQLRQLLDGTTDGFDDFGLQVPFPETGQQLVLLYGRRILSEGRPT
GHILLGVQPRQ
Download sequence
Identical sequences A0A076HV94

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]