SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A076LLY1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A076LLY1
Domain Number 1 Region: 5-159
Classification Level Classification E-value
Superfamily PTS IIb component 1.44e-50
Family PTS IIb component 0.0000633
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A076LLY1
Sequence length 160
Comment (tr|A0A076LLY1|A0A076LLY1_9GAMM) PTS system, N-acetylgalactosamine-specific IIB component {ECO:0000313|EMBL:AIJ08886.1} KW=Complete proteome OX=667120 OS=Edwardsiella anguillarum ET080813. GN=ETEE_2445 OC=Hafniaceae; Edwardsiella.
Sequence
MSNPNILMTRIDNRLVHGQVGVTWTNTLGANLVLVANDAAAADPVQQNLMDMVVAEGVQT
RYFTLQKTIEVIHRAADRQKIFIVCKTPQDVLTLVRGGVPIHFVNVGNMHFAQGKRQIHK
TVSVDGEDIAAFHALAQLGIPCEIRRVPDEAGESIHPLLD
Download sequence
Identical sequences A0A034T479 A0A076LLY1
WP_034163175.1.20341 WP_034163175.1.32312 WP_034163175.1.45880 WP_034163175.1.69651 WP_034163175.1.79796 WP_034163175.1.82304 WP_034163175.1.86133 WP_034163175.1.93273 WP_034163175.1.9786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]