SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A076LNU8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A076LNU8
Domain Number 1 Region: 1-66
Classification Level Classification E-value
Superfamily N-terminal, cytoplasmic domain of anti-sigmaE factor RseA 1.57e-20
Family N-terminal, cytoplasmic domain of anti-sigmaE factor RseA 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A076LNU8
Sequence length 212
Comment (tr|A0A076LNU8|A0A076LNU8_9GAMM) Sigma-E factor negative regulatory protein {ECO:0000256|PIRNR:PIRNR016938} KW=Complete proteome OX=667120 OS=Edwardsiella anguillarum ET080813. GN=ETEE_0880 OC=Hafniaceae; Edwardsiella.
Sequence
MQKEKLSALMDGELLDSELIGSLSKAPELQQTWQRYHLIRDTLRGDVGETLQIDLTDRIA
AALEDEPVRLVPNAIPESQPQPSAWQRMPFWSRVRPWAGQISQMGIAAGVSLAVLLGVQH
YNKPLEGVSEPESPVFNTLPLGGQASPVSFGVPSEGNNAQQQIQQQRKRINAILQDYELQ
RRLHAEQLQTEDSNAQASIQVPGTLSLGTQQQ
Download sequence
Identical sequences A0A034T2P7 A0A076LNU8
WP_034165585.1.20341 WP_034165585.1.32312 WP_034165585.1.45880 WP_034165585.1.69651 WP_034165585.1.86133 WP_034165585.1.93273 WP_034165585.1.9786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]