SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A076MTP7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A076MTP7
Domain Number 1 Region: 13-74
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000432
Family Anti-sigma factor antagonist SpoIIaa 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A076MTP7
Sequence length 100
Comment (tr|A0A076MTP7|A0A076MTP7_AMYME) Uncharacterized protein {ECO:0000313|EMBL:AIJ22291.1} KW=Complete proteome; Reference proteome OX=1068978 OS=Amycolatopsis methanolica 239. GN=AMETH_2199 OC=Amycolatopsis.
Sequence
MADRAEVDIRTAVVDDEVVRVHVAGEVDLLTVPSLAEALAAAGRLSPRLIQVDLSAVDFL
SVSGAAELAEAAARIPVQVGPASHASRVALAAAGLDHLLA
Download sequence
Identical sequences A0A076MTP7
WP_017981507.1.21974 WP_017981507.1.5303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]