SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A076MZ73 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A076MZ73
Domain Number 1 Region: 3-65
Classification Level Classification E-value
Superfamily XseB-like 3.01e-16
Family XseB-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A076MZ73
Sequence length 71
Comment (tr|A0A076MZ73|A0A076MZ73_AMYME) Exodeoxyribonuclease VII small subunit {ECO:0000256|HAMAP-Rule:MF_00337} KW=Complete proteome; Reference proteome OX=1068978 OS=Amycolatopsis methanolica 239. GN=AMETH_5851 OC=Amycolatopsis.
Sequence
MTEELGYEQARDQLIEVVRELEAGGLSLEQSLALWEKGEHLAKLCERHLEGARERIEDAL
KSVEDETGDEG
Download sequence
Identical sequences A0A076MZ73
WP_017984779.1.21974 WP_017984779.1.5303 WP_017984779.1.58790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]