SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A076W0C5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A076W0C5
Domain Number 1 Region: 1-89
Classification Level Classification E-value
Superfamily Barstar-related 2.88e-26
Family Barstar-related 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A076W0C5
Sequence length 91
Comment (tr|A0A076W0C5|A0A076W0C5_BACMY) Barstar {ECO:0000313|EMBL:AIK35350.1} KW=Complete proteome OX=1405 OS=Bacillus mycoides. GN=DJ92_5685 OC=Bacillus cereus group.
Sequence
MEIIQLDGRKFTSKEVLHKILKEKLDLPNYYGENADALWDCLTGWIDTPVTIEWEFFEES
KKMLGSYADLILETFQDAQEKMTEEYFIVVK
Download sequence
Identical sequences A0A076W0C5
WP_018783464.1.26964 WP_018783464.1.38413 WP_018783464.1.91021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]