SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077AZL2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077AZL2
Domain Number 1 Region: 45-104
Classification Level Classification E-value
Superfamily DNA-binding domain 1.77e-21
Family GCC-box binding domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A077AZL2
Sequence length 239
Comment (tr|A0A077AZL2|A0A077AZL2_VITAE) C-repeat binding factor 3 {ECO:0000313|EMBL:AIL00697.1} OX=3605 OS=Vitis aestivalis (Grape). GN=CBF3 OC=Pentapetalae; rosids; Vitales; Vitaceae; Vitis.
Sequence
MESERDQSSPSSSSSSSQTKCSISSSPVXKRKAGRKKFRETRHPVYRGVRQRNGNRWVCE
VRDPKNKSRIWLGTFPTPEMAARAHDVAALAFRGDFAALNFPDSTSRLPRAKSSSARDIQ
MAALAAAMAFRPAAPSSSSSYISHVTACSEELETSCSEDSPQLESRKKVVGVALEDSESS
QSAPHGSSTVFMDEEALFNMPGLINSMAEGLLLAPPTMLGGFSWDDTTSYTDLSLWNDD
Download sequence
Identical sequences A0A077AZL2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]