SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A077F9V6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077F9V6
Domain Number 1 Region: 392-479
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000392
Family Anti-sigma factor antagonist SpoIIaa 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A077F9V6
Sequence length 481
Comment (tr|A0A077F9V6|A0A077F9V6_9PSED) Sulfate permease {ECO:0000313|EMBL:AIL61285.1} KW=Complete proteome OX=237609 OS=Pseudomonas alkylphenolica. GN=PSAKL28_20640 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MRTTSIRADILAGLTTSFALVPECIAFALVAHLNPLMGLYGAFIICTLTALLGGRPGMIS
GAAGSMAVVIVALVVQHGVQYLLATVLLGGLIMIAFGLLRLGKLVRMVPYSVMLGFVNGL
AIIIALAQLEHFKHDGAWLSGSPLYLMAGLVALTMAIVYVLPRLTRSVPPALIAILGVGA
GVYLLDLPTRTLGDLAHIAGGLPVPSWPDIPWNLETLKIIAPYAILMALVGLLETLLTLN
LTDEITESRGYPNRECVALGVANMTSGVFGGMGGCAMIGQTAINLSSGGRGRLSGVVAGV
MILMFVLFLSPLIERIPLAALVGVMFVVAQQTFSWASLRVLHKVPANDMLAIIAVTVVTV
VTDLATAVLFGIVIAALNFAWQQARELYADSHLESDGSKLYRVHGTLFFASTTPFLNQFD
PANDPAQVTLDCQHLNFVDYSAIAALKTLRERYSNNGKHLRVVHLSERCKQLLKRTDLHY
S
Download sequence
Identical sequences A0A077F9V6
WP_038609855.1.97771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]