SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077HMA5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077HMA5
Domain Number 1 Region: 1-195
Classification Level Classification E-value
Superfamily ITPase-like 1.54e-62
Family ITPase (Ham1) 0.0000171
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A077HMA5
Sequence length 199
Comment (tr|A0A077HMA5|A0A077HMA5_9CORY) Nucleoside-triphosphate pyrophosphatase {ECO:0000256|HAMAP-Rule:MF_01405} KW=Complete proteome; Reference proteome OX=401472 OS=Corynebacterium ureicelerivorans. GN=CUREI_09150 OC=Corynebacterium.
Sequence
MVKVLVASRNQGKVRELEQVLRELNIDGVELVSLNEAPAYPDPVEDGLSFAENALLKARA
GAKATGLACVADDSGLTVEALNGMPGILSARWSGTHGDDQANNDLLLAQMADINERAAAF
VSCCALATPAGEEHTAEGRWEGELLREPRGKNGFGYDPLFQPADADGRSSAELTAEEKNA
RSHRGKALRALAPHIAALA
Download sequence
Identical sequences A0A077HMA5
WP_038612855.1.72044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]