SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077LN40 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077LN40
Domain Number 1 Region: 3-129
Classification Level Classification E-value
Superfamily FlgN-like 1.2e-28
Family FlgN-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A077LN40
Sequence length 155
Comment (tr|A0A077LN40|A0A077LN40_9PSED) Flagellar protein FlgN {ECO:0000313|EMBL:BAP44138.1} KW=Complete proteome; Reference proteome OX=1028989 OS=Pseudomonas sp. StFLB209. GN=PSCI_3436 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MQDTTLLQMITDDMAPTRQLLDLLQAESLVLHGRDMTEMEQVLAKKQALVVQLEQHGRRR
SQVLAGLGLPTNRAGLEELASQSAVGEQLLQAGDELASLISDCQALNEQNGKLIQLQQMT
TAHQLRILNGGDTPTLYDNRGSTAGRARPRPLSQA
Download sequence
Identical sequences A0A077LN40
WP_045489345.1.88027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]