SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077MVA8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077MVA8
Domain Number 1 Region: 5-141
Classification Level Classification E-value
Superfamily MIR domain 0.0000471
Family MIR domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A077MVA8
Sequence length 187
Comment (tr|A0A077MVA8|A0A077MVA8_XENBV) Uncharacterized protein {ECO:0000313|EMBL:CDG93612.1} KW=Complete proteome OX=1397852 OS=Xenorhabdus bovienii str. feltiae Florida. GN=XBFFL1_2560068 OC=Morganellaceae; Xenorhabdus.
Sequence
MANVILYGDILHIKNRHENGSYLDVYGQSASLGEKYNVVTSVSSNRDTGSGSWQILSAES
KSLGTEIYSGDTVFLVNFYRNNGGYLRVSGYAPSPELYNVYTADRPVNALDTAIWHIFTD
TANEFDGKIREGNAIRLLNSFNNVHGGFLDTCWLVNQPGAVYKVYTSLLSDRGNGTGTWI
LSKAINQ
Download sequence
Identical sequences A0A077MVA8 A0A077NEC1
WP_038203670.1.33677 WP_038203670.1.44656 WP_038203670.1.84134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]