SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A077NEC1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077NEC1
Domain Number 1 Region: 5-141
Classification Level Classification E-value
Superfamily MIR domain 0.0000471
Family MIR domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A077NEC1
Sequence length 187
Comment (tr|A0A077NEC1|A0A077NEC1_XENBV) Uncharacterized protein {ECO:0000313|EMBL:CDG96748.1} KW=Complete proteome OX=1398201 OS=Xenorhabdus bovienii str. puntauvense. GN=XBP1_2210022 OC=Morganellaceae; Xenorhabdus.
Sequence
MANVILYGDILHIKNRHENGSYLDVYGQSASLGEKYNVVTSVSSNRDTGSGSWQILSAES
KSLGTEIYSGDTVFLVNFYRNNGGYLRVSGYAPSPELYNVYTADRPVNALDTAIWHIFTD
TANEFDGKIREGNAIRLLNSFNNVHGGFLDTCWLVNQPGAVYKVYTSLLSDRGNGTGTWI
LSKAINQ
Download sequence
Identical sequences A0A077MVA8 A0A077NEC1
WP_038203670.1.33677 WP_038203670.1.44656 WP_038203670.1.84134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]