SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A077PDU6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077PDU6
Domain Number 1 Region: 5-143
Classification Level Classification E-value
Superfamily MIR domain 0.0000204
Family MIR domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A077PDU6
Sequence length 169
Comment (tr|A0A077PDU6|A0A077PDU6_XENBV) Uncharacterized protein {ECO:0000313|EMBL:CDH07901.1} KW=Complete proteome OX=1398202 OS=Xenorhabdus bovienii str. oregonense. GN=XBO1_680006 OC=Morganellaceae; Xenorhabdus.
Sequence
MANVILYGDILHIKNRHENGSYLDVYGQSASLGEKYNVVTSVSSNRDTGSGSWQILSAES
KSLGTEIYSGDTVFLVNFYRNNGGYLRVSGYAPSPELYSVYTTDRPVNALDTAIWHIFTD
TANEFDGKIREGNAIRLLNSFNNVHGGFLDTCWLANQPGAVYKVYTHRN
Download sequence
Identical sequences A0A077PDU6
WP_038253466.1.87433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]