SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A077PG90 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077PG90
Domain Number 1 Region: 157-343
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.44e-74
Family Methylesterase CheB, C-terminal domain 0.0000000531
Further Details:      
 
Domain Number 2 Region: 1-108
Classification Level Classification E-value
Superfamily CheY-like 7.26e-28
Family CheY-related 0.00000537
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A077PG90
Sequence length 350
Comment (tr|A0A077PG90|A0A077PG90_XENBV) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome OX=1398203 OS=Xenorhabdus bovienii str. kraussei Quebec. GN=XBKQ1_2240005 OC=Morganellaceae; Xenorhabdus.
Sequence
MNKITVLCVDDSALMRQIMREIINSHPDMEVVDCAPDPFVARDLIKKHNPQVLTLDVEMP
RMDGIDFLEKLMRLRPMPVVMVSSLTAKGSEITLKALELGAVDFVTKPQLGLREGMLAYS
ELIAEKIRAAAQAKISTMPSSPVIATPLNFKPLLSSEKLIAVGASTGGTEAIKNLLQPLP
VTSPALLITQHMPPGFTRSFAERLNKLSQITVKEAENGERVLPGHAYIAPGDHHMELCRS
GANYQIMTTRAPPVNRHRPSVDVLFRSVAKHAGRNAVGVILTGMGSDGAAGLLEMKQAGA
YTLAQSEASCVVFGMPRAAIQLGAIDDVMDIQKISKAMLAKISAGQSIRI
Download sequence
Identical sequences A0A077N7A8 A0A077NJ47 A0A077NUV3 A0A077PG90 A0A077PLG0 A0A077QPA4
WP_038190154.1.33677 WP_038190154.1.44656 WP_038190154.1.63801 WP_038190154.1.73871 WP_038190154.1.84134 WP_038190154.1.88548 WP_038190154.1.96151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]