SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A077PHF3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077PHF3
Domain Number 1 Region: 5-96
Classification Level Classification E-value
Superfamily MIR domain 0.0000471
Family MIR domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A077PHF3
Sequence length 186
Comment (tr|A0A077PHF3|A0A077PHF3_XENBV) Uncharacterized protein {ECO:0000313|EMBL:CDH20102.1} KW=Complete proteome OX=1398203 OS=Xenorhabdus bovienii str. kraussei Quebec. GN=XBKQ1_2450005 OC=Morganellaceae; Xenorhabdus.
Sequence
MANVILYGDILHIKNRYADGSYLDVYGQSASLGEKYNVVTSVSSNRDTGSGSWQILSAES
KNLGTEIYSGDTVFLVNCYRNNGGYLRVSGYAHSPELYNVYTADRPVNALDTAIWHIFTD
TANEFDGKIREGNAIRLLNSFNNVHGGFLDTCWLANQPGAVYKVYTSLLSDRGNGTGTWI
LSKAIN
Download sequence
Identical sequences A0A077PHF3
WP_038249000.1.88548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]