SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A077PWE2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077PWE2
Domain Number 1 Region: 5-141
Classification Level Classification E-value
Superfamily MIR domain 0.0000471
Family MIR domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A077PWE2
Sequence length 187
Comment (tr|A0A077PWE2|A0A077PWE2_XENBV) Uncharacterized protein {ECO:0000313|EMBL:CDH25016.1} KW=Complete proteome OX=1398204 OS=Xenorhabdus bovienii str. kraussei Becker Underwood. GN=XBKB1_350011 OC=Morganellaceae; Xenorhabdus.
Sequence
MANVILYGDILHIKNRHENGSYLDVYGQSASLGEKYNVVTSVSSNRDTGSGSWQILSAES
KSLGTEIYSGDTVFLVNFYRNNGGYLRVSGYAPSPELYNVYTADRPVNALDTAIWHIFTD
TANEFDGKIREGNAIRLLNSFNNVHGGFLDTCWLVNQPGAVYKVYTSLLSDRRNGTGTWI
LSKAINQ
Download sequence
Identical sequences A0A077PWE2
WP_038192625.1.63801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]