SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A077Q8C3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077Q8C3
Domain Number 1 Region: 458-559
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000106
Family Anti-sigma factor antagonist SpoIIaa 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A077Q8C3
Sequence length 579
Comment (tr|A0A077Q8C3|A0A077Q8C3_XENBV) Putative transport protein (SulP family) {ECO:0000313|EMBL:CDH32537.1} KW=Complete proteome OX=1379677 OS=Xenorhabdus bovienii str. Intermedium. GN=XBI1_200003 OC=Morganellaceae; Xenorhabdus.
Sequence
MNTRKINGIRPFSAFIDSCMKESYSFPRFIRDIIAGITVGVIAIPLAMALAIGSGVAPQY
GLYTAAIAGIVIAITGGSRYSVSGPTAAFVVILYPVSQQFGLSGLLIATLMSGVILIVMG
LARFGRLIEYIPMSVTLGFTSGIAITIATMQVQNFFGLKLVHIPENYIDKVVALSQAMSS
LQLSDTLIGLTTLLVLIFWPKLGVKLPGHLPALITGTAVMGAMHLLGYDVATIGSSFSYT
LADGTQGQGIPPILPQFVLPWNLPDTHSLDISWNTVSALLPAAFSMAMLGAIESLLCAVI
LDGMTGKKHHSNGELLGQGLGNIAAPFFGGITATAAIARSAANVRAGATSPIAAVVHSLL
VLLTLLVLAPMLSYLPLAAMSAILLIVAWNMSEAHKVVDLIRHAPKDDIIVMLLCLSLTV
LFDMVIAITIGIVLASLLFMRKIANMTRISTSSLTSAEKGLLVIRINGPLFFAAAERIFA
ELREKSADYQTIIMQWDAVPVLDAGGLHAFQGFVRELGKEKHIVVCDIPFQPLKTLARAK
VTPIEGELSFYATLPKALKEMAVDYTPELCASSEKIQGQ
Download sequence
Identical sequences A0A077Q8C3
WP_038180457.1.73871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]