SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A077QER1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077QER1
Domain Number 1 Region: 700-936
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.96e-19
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.015
Further Details:      
 
Domain Number 2 Region: 8-192
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.3e-17
Family Pyruvate oxidase and decarboxylase Pyr module 0.074
Further Details:      
 
Domain Number 3 Region: 406-589
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.0000000441
Family PFOR PP module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A077QER1
Sequence length 1122
Comment (tr|A0A077QER1|A0A077QER1_XENBV) Putative oxyreductase protein {ECO:0000313|EMBL:CDH31535.1} KW=Complete proteome OX=1379677 OS=Xenorhabdus bovienii str. Intermedium. GN=XBI1_1570009 OC=Morganellaceae; Xenorhabdus.
Sequence
MTRHYPSKFVTGTDALAELLLAQAELDKSHNLNTAGFVSGYRGSPLARLDQALWQHGKEL
AQANIRFQPAINEDLAATALIGTQKVESDPDRNVIGVFGMWYGKGPGVDRSGDALRHGNA
YGSSPHGGVLVLLGDDHGCVSSSMSHQSDLALMAWSMPILHPASVSDYHDVGLWGWAASR
ASGAWVGFKAISEVVESSAIRESKPFPEYETPEIDSGPDGLHWRWPDLPGPQIEKRLAYK
LKAVEAFARANPIDQLLAPCAHPRALLVTVGKAHRDVLEALRAGGLAPSQLAKQGVAFVH
IRLVYPLSPLLSDLASQVTDIFVIEEKTAVVEILLARHLVNSQKNIKLIGKHNHLGQQLL
PADIELRPSLITPLLSGWLHKLDLFLSVPLEWATKTTPHDLTLPKRTPYFCAGCPHSTST
RLPDGSQAHIGIGCHVMAAWMDRNTGFGFVQMGGEGADWVGHSPFINRPHVFQNLGDGTY
FHSGHLSIRQSVAAGNRITYKLLFNQAVAMTGGQPLDGNLTIPQIAALMLSEGVKEVAIV
TDNIDKYQDKNLLPAKVTLYQRDYLEEVQKRFREIAGVTVIIYDQACATELRRKRKRGLE
PKATRRAVINELVCEGCGDCQVQSNCLAVIPVKTPLGTKRKIDQHVCNSDLSCLKGFCPS
FVTVENANPRHDLSKIIPQGDLDKLLRELPQPTPIISDNPYEILLVGVGGTGIVTAGNLL
AIAAEADNYSVSLLNFTGFAQKGGEAITHVRLCHDMNKLHQVRIDRGRANLVIAADLVAT
TGQNSLTVMSKNTTKCVLNTHETQIGTMLRAPTLNLDHPKMMTTLHQHCQTLNSIDAEIM
AADLVGDRNQTNIVLIGYAWQLGKIPITLSAIDHTIQALGNAADSARRAFHIGRIAAVQP
DILNERLHIKPQKSIKTLDDLIMHRYQFLVDYQNERYAQRYLSRVAQIQLVTQQIDAEEI
AKAVAENLFKLMAYKDEYEVARLYAKSDFFENLRSQFDNTDNIRFHLSLPLFNRKDPRTG
ERGKREYGTWIIPILRVLAACKPLRGTMFDIFGYQEERKQERNLLLEYERLLDFLIEKLN
RDNLAICQQLAELPDQVRGFGHVKQKAIRNMMERKAALLEEL
Download sequence
Identical sequences A0A077QER1
WP_038184545.1.73871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]