SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077S1M2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077S1M2
Domain Number 1 Region: 16-103
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000353
Family B3 DNA binding domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A077S1M2
Sequence length 123
Comment (tr|A0A077S1M2|A0A077S1M2_WHEAT) Uncharacterized protein {ECO:0000313|EMBL:CDM84940.1} OX=4565 OS=Triticum aestivum (Wheat). GN=TRAES_3BF002300110CFD_c1 OC=Pooideae; Triticodae; Triticeae; Triticinae; Triticum.
Sequence
MAQQLRDSPDLAGFEFYKLMASGTSWEKLNVPVEFSQSHGFTEKGRVVLRMRGQQWSVCL
KHSNRRKGNARTRTALRYGWNRFRVDNGLHVGDICFFQLVHDAGGDDPVLSVEVRKADGT
IVQ
Download sequence
Identical sequences A0A077S1M2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]