SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A077TSP1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077TSP1
Domain Number 1 Region: 5-301
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.71e-79
Family Capz alpha-1 subunit 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A077TSP1
Sequence length 307
Comment (tr|A0A077TSP1|A0A077TSP1_PLACH) F-actin capping protein, alpha subunit, putative {ECO:0000313|EMBL:CDR15029.1} KW=Complete proteome OX=31271 OS=Plasmodium chabaudi chabaudi. GN=PCHAS_124350 OC=Plasmodiidae; Plasmodium; Plasmodium (Vinckeia).
Sequence
MDSLLNEKKKFIRHVLSNAPPGKISDLISNLKVLFGSNAIIQNFIEDIISNYNEDNHILI
PFENDEYIIICKQSKNGNLYLHPNLKILANVNHLKRKVVDTTPLAKFDYSDILEKYRQAC
NIKLKEYVDIYYKKWSEHQTENYPTVNIGSKHGLNVKCTSSVYASESENKYNLFLIICCD
RYYLKNFHASSWRSSWDVKFLETDQEIPLTGTIDVVLTYFEDANINFKTQKVFEKRVSVT
NDVESFASSILSVIRECENDVLYDLNHFIANTSNGLIKNTRKIIPLNGDKFYWMETYQDI
PTQIKLI
Download sequence
Identical sequences A0A077TSP1
XP_016654370.1.12432 PCAS_124350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]