SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A077WMU0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077WMU0
Domain Number 1 Region: 341-527
Classification Level Classification E-value
Superfamily MIR domain 3.79e-47
Family MIR domain 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A077WMU0
Sequence length 751
Comment (tr|A0A077WMU0|A0A077WMU0_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:CDS08931.1} OX=688394 OS=Lichtheimia ramosa. GN=LRAMOSA10291 OC=Lichtheimiaceae; Lichtheimia.
Sequence
MDNLKRRHTTTQNGMAACILAEEGYDPISLNDDQDDIYAEKERSFRNRYSHTSGYKKYMA
AAKKYQHVLIPTTLTLLSFITRFYDLARSDSVVWDEAHFGKFGSYYLKREYYFDVHPPLG
KMLVGLSGWLVGYDGSFDFQSGAAFPEGLNYWGMRLFNAAWGAFMVPLAYGTAKEFGMSM
RASILAATMVLLDTAYLCISRFILLDSMLLFFTCTSLYCLAKLRNTRQQPFSKQWWLWMF
MTGLSLGCVSSVKWVGLFAVAMVGVYTLEELWELFGDPQLSITVYAAHWVARAITLIAVP
MAVYVACFKAHFTVLSKSGPGDNQMSSLFQAQLEGNKFGESPLEIAFGSEVTIKSQLLGG
GLLHSHVQKYPEGSQHQQITIYHHKDDNNNWILHPVDAQGDVNQDEIQYIQDGDHVRLLH
MRTKVYLHSHDMPGFVTSEHYEVGGHGTEEEPVIGNTWKFEVHDDIGAMSNENNRIHTLS
TRFRLRHAELGCLLRSEKASLPQWGFKQGEMTCDPNAKNNDPGVLWNIEEHKNEKLPPAG
KQAYRSKFWRDFIQLNVGMWRSNNALIPDPDKEDRLTSAPTEWPLVSIGMRICGWGEKNV
RYLLIGNPAVWWASAASLAIFGLTVAIYNVRMRRHGSHVLQGKMDDFYFTGKTLLIGWFF
HYLPFFIMGRVTYLHHYFPALYFSIFMVPLLIDHFVAQSSPRTQSLVFTTAFALVISAFI
YFSPAAFGMTGPLDKYAGKMWFRNWRFADEE
Download sequence
Identical sequences A0A077WMU0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]