SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A077WTN6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077WTN6
Domain Number 1 Region: 261-409
Classification Level Classification E-value
Superfamily MIR domain 5.32e-22
Family MIR domain 0.0015
Further Details:      
 
Domain Number 2 Region: 535-708
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000000000000445
Family IP3 receptor type 1 binding core, domain 2 0.0056
Further Details:      
 
Domain Number 3 Region: 131-276
Classification Level Classification E-value
Superfamily MIR domain 0.00000419
Family MIR domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A077WTN6
Sequence length 2603
Comment (tr|A0A077WTN6|A0A077WTN6_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:CDS10680.1} OX=688394 OS=Lichtheimia ramosa. GN=LRAMOSA11166 OC=Lichtheimiaceae; Lichtheimia.
Sequence
MARSKEQFLCLGDEICFFDEEGNALSVEDPLETRACARRVGAPMLTEQQRQQQHDQTLPL
EAIGTRIFRIEPQQSYSERRALEQFIGSQDERDSLYYEGSPDELIELSVLEAKATKERAQ
NETERRRVHGNPVLYGEVVQLYNAHFKKYLTVTGKPCRSDASHLQVNLSNEVVGYFRIVP
RYRIRVDGEPVRLGDTVALQCLRPEGFLNVGSRVLHSSAFNTDYYEVYTHTRIASWTFRC
HRSARASHDPDATKYINSAQYVRFYHKEMEAYLESPVLQRDKHGVRLRKHIINPLDPKES
DSPLAFWEIENVNPSDGSKVQWKKPIRIRHAASRAYLHIDPNSVSIDMNTQKISYSFRLV
RNPRCIDGNDGTLFKFVPVSDPSRSGVPFGSYVRIQHVLTKCWMHAATESELRSSSLSPT
PVALTLTPDPTDTTNNSQPSFSSQQQHPQQQPTRFFSTDSSSAEDHTQSTAGSPLSKISA
SQEFHYHDCFSITLVDNQLSDTFNIVNELLPQLQCFLMQSRPVSDDTISNSRFPISDEEY
ILITDILQILIEFCTESREIDPALRVGLPIKYHQSLLRDIGIIETIIAMIRVPFDLSKRY
ETRASLQYGPIHHSRAEQHHTEHAVSVGSLLDNSEPQLKSIISLCYNLLRVFLISGGQDD
DYNDPSNVVENQWHVIHVAGDTGIELFMRHLTCGVGATDLLVRLISNNSSIVDFLCHMRP
QHNTIGILLDQAFDKSRHMMMEWSGDEDQYEAASSIELLSTICRNDALTQHRNYIATSIF
EPLFLLETRMEDGRVEARILDKDDEAWHSLTELVVDKPALSNMLHSILQLICSVSLGASP
KVVDYARHCIPKDICLKCLGDVSLPDRIRARFCDLLRVLYIDVQPFSNVILSDFSMEYEK
LDDSDDYPSSGISHTESDTPKFFERLKHWLLVFLDDKCHQFTANRDEVEFLGSALKMVQT
QLRLGFFTDARDMKRLFRALILVLDGRTDARNEEHLKSIKSDAARHWKERFNLTEETQPV
MNTKILILEIFDLIYDLRLRVRMNKLAFKWKNMETQVDNQLQHSPRLVLTQIFQDTMLRQ
RENSLMPILKDILKYKYAPLKRIAAIVMHRIYNDSEDMFNKAPQVLLLSQPQQVFVYHGV
KKRLTQLRSLLFGGEHLDPNQLHNVDHILYDFIDLFRGKTIDYDDTMVDLEDNNASQRNI
YSKIFTNLNAHAIIIELLLNLKAVDNKQTGSTSSLSSSLDELDDDHNSNHEIVHVNVLKT
CLEFLEELIKQDKDLQSQLVLSNVDLLLDIGGMHPTLAQSLYNIFGNNLYISIRIKERHI
KRILEQSHGVQSEYLHLLNALIKAQGKLLKKHQDCVMRLVMDNRDYYVPFKSPDELVSSK
QYIDYYVALVDLLAVCGQGDNAFGQSFARTIFSIHDIFVIIKDDDVHLSLKAAMLRFLAS
TYLDNPDVLSHISNSDDQCIRALMQWSYDEMSDFISSTEHSDMEIEYIYNGILLFLRPLF
EHSLSVEITVDEMLCVLCPRLIDKTVELMMLPKCSDKDNDSGRQRLQNTLACLDSMINVA
GFPGTVIDPTELRSRLRAAMVELTNQTKASVQTLDSMNAKFQGFIRALTAHKDVKSLMQT
EFKQLGSHFNLSSRGSDQDVKSLVEYLSMTTNIKHHDPREEYQVATINLLEEIPLQYIRE
RSFVSHSDDPEQYEILEKKKVHAQNTLNRLGCTLVAQNLLSSPRRQIFEAALKLLIALLE
GGNKNVQDNLEEYFYSIREERFFYSFHHRLQSGIASLKEAQQHLLRAAYKMNRQQSILGS
NLPTKRSNAIESMMPAAISSRRKQQQEQQATNKKKRQHQRHRSSLDVSRMHMRKRLLGHH
HQVSKNAESSPMVYQKISNLMASETAEFGTTSEDFQGMKDTMRALQLMVEGHNINLQLYL
ARQPDNIKSFNIVQDVVEYLHTIVPICNIQNVRLIIQVLDTITELAQGCVENQRTIFAGK
ILNPANTILRERYTNCPSTLIEELKSKVVTCLLSLLEGGIENSESIFREMSGSLDLSVIV
HNMNAIYDKNADQINSPHAYEKLNSGFQYCILLMTLWPALDENQRTMLDGNRAFEFFQSH
SGKIEVVMESHQEKQLSRVLFPIPEVCKYLREDTKQRFLWNVKRDSPSAKIEDFVQLSDN
IIYEIENHAKVARSQYLSFLTAYSTWWWRASYAVTLLLNLLILSSSESILIVDGATGAYC
NRFKNMARFLLGIFHLLFWTLSTAEFFFIELPILVNRHNTGIKVSSTAIMQAGNRQASSS
TSINASGNNFASSLLKKLSHTTGGLATSLCEHSFLYHLIMLAFSVFGLYNPGFYSVHLLD
FAFRDRILQGVIASITLNVNSITRTGLLAIIVVYIHSVIAYMFFRFEFDMTKGLHCSTLT
KCFVTVLSHGVRSGGGIGDILEPDTAQEPRGWRTAFEMSFFLLVVVFLLNAIFGIIFDTF
GHLRDERSAVQHDMKDSCFICSIPSVEFQRHAKKGFDNHVKHDHNIWQYLFFMVHLKNKD
RTEYTGPESYVSECLKEANYSFFPINRALCLHQNEDDDGERLEKLEELTQSLIQKVNAME
EHVEKLAESHSRSRSNSLMLSPM
Download sequence
Identical sequences A0A077WTN6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]