SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A077XNE1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077XNE1
Domain Number 1 Region: 278-356
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000863
Family Anti-sigma factor antagonist SpoIIaa 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A077XNE1
Sequence length 377
Comment (tr|A0A077XNE1|A0A077XNE1_9SPHI) Sulfate permease family inorganic anion transporter {ECO:0000313|EMBL:CDS92482.1} OX=403776 OS=Sphingobacterium sp. PM2-P1-29. GN=BN1088_1430886 OC=Sphingobacteriaceae; Sphingobacterium.
Sequence
MSQVEQFKTVDASGVTHWLSGPSAYIMLGLTLFAAFVVYVFPKISKTIPASLIAILATFL
VVYIFRIDTKTVGDIASVKGNLPAFHIPELPFSWETLMIIFPFSLIMASVGLIESLLTLS
MVDELTNTKGNANREAMAQGAANLVNGFFGGMGGCAMVAQTLVNINAGSRSRLSGIIGAL
TILTIILVASPLIEQIPMAALVGVMMVVAIGTFQWVSFRIITKMPKSDIFVGMLVALITI
VLHNLALAVLVGVVIAALVFAWDNAKRIRARKTIDAAGNKVYEIYGPLFFGSVTGFLEKF
DINDDPQYVIVDFKESKITDMSAIDAVNKLAEKYQSQSKILRLRHLSEDCKAILKKAESP
VLIETSENDPTYRVMPK
Download sequence
Identical sequences A0A077XNE1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]